PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025894P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 298aa    MW: 33303.9 Da    PI: 6.1819
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025894P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.91.1e-28150203155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl Wtp+LH+rFv++v++L G + A Pk+i+++m+v+gLt+e+v+SHLQkYRl
  MELO3C025894P1 150 RPRLAWTPQLHKRFVDVVSHL-GLKDAAPKAIMQMMNVEGLTRENVASHLQKYRL 203
                     59*******************.9999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.42E-19147207IPR009057Homeodomain-like
PROSITE profilePS512949.29147206IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-29149207IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-22151203IPR006447Myb domain, plants
PfamPF002495.6E-9152202IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEKKKREFQF GGGNGCGNED ERVLLWEDGL PDVEKLTPLS QSLISQELAS AFRILMEPHR  60
SILDVNSASK MTIMNIRDGQ SEGYRSFEFK YDQTRREDVV MVESDEGINP DDLGSDSRKL  120
RRVDCVEETN IAPRAESLIE DAALARTLKR PRLAWTPQLH KRFVDVVSHL GLKDAAPKAI  180
MQMMNVEGLT RENVASHLQK YRLYLKRTQI SSTTDEALVP MPVTQNAHDS SPSAADSHGN  240
DCFPATFPMT YMPFPMMPMM FYGMGAHGHG LSQTAMPMVN LTNVPTHSCS TKGQHDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-18149207462ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819190.0LN681919.1 Cucumis melo genomic scaffold, anchoredscaffold00084.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464103.10.0PREDICTED: transcription factor PCL1
SwissprotQ9LTH41e-51PCLL_ARATH; Transcription factor BOA
TrEMBLA0A0A0KH890.0A0A0A0KH89_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g05120.t019e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69573347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.11e-52G2-like family protein